Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CQYLKDYLTRLLVPYVVNVSWATQYCSRAQCHGHGRCVRRNPSASTFLHL STNSFRLVPGHAPGEPQLRPVGELSWADIDHLQTHFRCQCYLGWSGEQCQ
    • Amino acids
      340 to 439
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152907 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Hyal 2
    • Hyal-2
    • Hyal2
    • HYAL2_HUMAN
    • Hyaluronidase 2
    • Hyaluronidase 2 Precursor
    • Hyaluronidase-2
    • Hyaluronoglucosaminidase 2
    • Hyaluronoglucosaminidase-2
    • LUCA 2
    • LUCA-2
    • LUCA2
    • Lung carcinoma protein 2
    • lysosomal hyaluronidase
    • PH 20 homolog
    • PH-20 homolog
    • PH20 homolog
    see all
  • Function
    Hydrolyzes high molecular weight hyaluronic acid to produce an intermediate-sized product which is further hydrolyzed by sperm hyaluronidase to give small oligosaccharides. Displays very low levels of activity. Associates with and negatively regulates MST1R.
  • Tissue specificity
    Widely expressed. No expression detected in adult brain.
  • Sequence similarities
    Belongs to the glycosyl hydrolase 56 family.
    Contains 1 EGF-like domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab152907 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152907 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152907.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up