Recombinant Human Hyaluronidase PH20 protein (ab114725)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RSMKSCLLLDNYMETILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSS DYLHLNPDNFAIQLEKGGKFTVRGKPTLEDLEQFSEKFYCSCYSTLSCKE
    • Molecular weight
      37 kDa including tags
    • Amino acids
      346 to 445

Specifications

Our Abpromise guarantee covers the use of ab114725 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • epididymis secretory sperm binding protein Li 96n
    • HEL-S-96n
    • HYA1
    • HYAL PH-20
    • HYAL PH20
    • Hyal-PH20
    • HYAL1
    • HYAL3
    • HYAL5
    • HYALP_HUMAN
    • Hyaluronidase PH-20
    • Hyaluronoglucosaminidase PH-20
    • MGC26532
    • PH-20 Hyaluronidase
    • PH20
    • PH20 Hyaluronidase
    • SPAG15
    • SPAM-1
    • Spam1
    • Sperm adhesion molecule 1
    • sperm adhesion molecule 1 (PH-20 hyaluronidase, zona pellucida binding)
    • Sperm surface protein PH-20
    • Sperm surface protein PH20
    • zona pellucida binding
    see all
  • Function
    Involved in sperm-egg adhesion. Upon fertilization sperm must first penetrate a layer of cumulus cells that surrounds the egg before reaching the zona pellucida. The cumulus cells are embedded in a matrix containing hyaluronic acid which is formed prior to ovulation. This protein aids in penetrating the layer of cumulus cells by digesting hyaluronic acid.
  • Tissue specificity
    Testis.
  • Sequence similarities
    Belongs to the glycosyl hydrolase 56 family.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human Hyaluronidase PH20 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human Hyaluronidase PH20 protein (ab114725)

ab114725 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us. Because we carry over 90,000 products, it isn't feasible for us to keep small sample sizes of our products.

We are happy to reassure our customers that all of our products are covered by our Abpromise, which guaran...

Read More

Merci de nous avoir contactés.

Le laboratoire vient de me confirmer que la concentration de la protéineHyaluronidase PH20, lot GR98907-1 est de 0.1 mg/ml.

La concentration de cette protéine dépend du lot, l...

Read More

Thank you for contacting us and sorry for the delay of our reply.

I just received a reply from the source of the Hyaluronidase PH20 protein ab114725. They confirmed that this protein has not been tested for functional studies.
All tested a...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up