Recombinant Human Hydrogen Potassium ATPase Beta protein (ab114502)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAF LAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLA DPNFGFEEGK
    • Molecular weight
      38 kDa including tags
    • Amino acids
      67 to 176

Specifications

Our Abpromise guarantee covers the use of ab114502 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Gastric H(+)/K(+) ATPase subunit beta
    • ATP4B
    • ATP4B_HUMAN
    • ATP6B
    • ATPase H+/K+ exchanging beta polypeptide
    • ATPase H+/K+ transporting beta polypeptide
    • Gastric H K ATPase catalytic subunit
    • Gastric H(+)/K(+) ATPase subunit beta
    • Gastric H+/K+ ATPase beta subunit
    • Gastric hydrogen potassium ATPase
    • Gastric hydrogen potassium ATPase beta
    • Hydrogen/potassium exchanging ATPase 4B
    • OTTHUMP00000178856
    • Parietal cell antigen
    • Potassium transporting ATPase beta chain
    • Potassium transporting ATPase subunit beta
    • Potassium-transporting ATPase subunit beta
    • Proton pump
    • Proton pump beta chain
    see all
  • Function
    Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.
  • Sequence similarities
    Belongs to the X(+)/potassium ATPases subunit beta family.
  • Domain
    The C-terminal lobe folds into an immunoglobulin-like domain and mediates cell adhesion properties.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab114502 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114502 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114502.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up