Recombinant Human Hydrogen Potassium ATPase Beta protein (ab114502)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP51164
    • SpeciesHuman
    • SequenceDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAF LAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLA DPNFGFEEGK
    • Molecular weight38 kDa including tags
    • Amino acids67 to 176

Specifications

Our Abpromise guarantee covers the use of ab114502 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Gastric H(+)/K(+) ATPase subunit beta
    • ATP4B
    • ATP4B_HUMAN
    • ATP6B
    • ATPase H+/K+ exchanging beta polypeptide
    • ATPase H+/K+ transporting beta polypeptide
    • Gastric H K ATPase catalytic subunit
    • Gastric H(+)/K(+) ATPase subunit beta
    • Gastric H+/K+ ATPase beta subunit
    • Gastric hydrogen potassium ATPase
    • Gastric hydrogen potassium ATPase beta
    • Hydrogen/potassium exchanging ATPase 4B
    • OTTHUMP00000178856
    • Parietal cell antigen
    • Potassium transporting ATPase beta chain
    • Potassium transporting ATPase subunit beta
    • Potassium-transporting ATPase subunit beta
    • Proton pump
    • Proton pump beta chain
    see all
  • FunctionRequired for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.
  • Sequence similaritiesBelongs to the X(+)/potassium ATPases subunit beta family.
  • DomainThe C-terminal lobe folds into an immunoglobulin-like domain and mediates cell adhesion properties.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human Hydrogen Potassium ATPase Beta protein images

  • ab114502 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Hydrogen Potassium ATPase Beta protein (ab114502)

ab114502 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114502.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"