Overview

  • Product name
    Recombinant Human HYPE protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAVTEPKWVSVWSRFLWVTLLSMVLGSLLALLLPLGAVEEQCLAVLKGLY LLRSKPDRAQHAATKCTSPSTELSITSRGATLLVAKTKASPAGKLEARAA LNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQA DYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIP KGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLE EQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRF RTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKL VYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEG DVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP
    • Amino acids
      1 to 449
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161327 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Adenosine monophosphate-protein transferase FICD
    • AMPylator FICD
    • FIC domain containing
    • FIC domain containing protein
    • FIC domain-containing protein
    • Fic S phase protein cell division homolog
    • ficd
    • FICD_HUMAN
    • HIP-13
    • HIP13
    • Huntingtin interacting protein 13
    • Huntingtin interacting protein E
    • Huntingtin interactor protein E
    • Huntingtin yeast partner E
    • Huntingtin-interacting protein 13
    • Huntingtin-interacting protein E
    • MGC5623
    • UNQ3041
    see all
  • Function
    Adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins. Able to inactivate Rho GTPases in vitro by adding AMP to RhoA, Rac and Cdc42. It is however unclear whether it inactivates GTPases in vivo and physiological substrates probably remain to be identified.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the fic family.
    Contains 1 fido domain.
    Contains 2 TPR repeats.
  • Domain
    The fido domain mediates the adenylyltransferase activity.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab161327 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161327 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161327.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up