Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP22362
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMKSMQVPFSRCCFSFAEQEIPLRAILCYRN TSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
    • Molecular weight11 kDa including tags
    • Amino acids24 to 96
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104828 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab104828 is purified using conventional chromatography techniques, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 7.5

General Info

  • Alternative names
    • C-C motif chemokine 1
    • Ccl1
    • CCL1_HUMAN
    • Chemokine CC Motif Ligand 1
    • inflammatory cytokine I-309
    • P500
    • SCYA1
    • SISe
    • small inducible cytokine A1
    • Small-inducible cytokine A1
    • T lymphocyte secreted protein I-309
    • T lymphocyte-secreted protein I-309
    • TCA3
    see all
  • FunctionCytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8.
  • Sequence similaritiesBelongs to the intercrine beta (chemokine CC) family.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human I-309 protein images

  • 15% SDS-PAGE showing ab104828 at approximately 10.8kDa (3µg).

References for Recombinant Human I-309 protein (ab104828)

ab104828 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104828.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"