Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMKSMQVPFSRCCFSFAEQEIPLRAILCYRN TSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
    • Molecular weight
      11 kDa including tags
    • Amino acids
      24 to 96
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104828 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab104828 is purified using conventional chromatography techniques, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 7.5

General Info

  • Alternative names
    • C-C motif chemokine 1
    • Ccl1
    • CCL1_HUMAN
    • Chemokine CC Motif Ligand 1
    • inflammatory cytokine I-309
    • P500
    • SCYA1
    • SISe
    • small inducible cytokine A1
    • Small-inducible cytokine A1
    • T lymphocyte secreted protein I-309
    • T lymphocyte-secreted protein I-309
    • TCA3
    see all
  • Function
    Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8.
  • Sequence similarities
    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab104828 at approximately 10.8kDa (3µg).

References

ab104828 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104828.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up