Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP55008
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSQTRDLQGGKAFGLLKAQQEERLDEINKQ FLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVP KTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKARE KEKPTGPPAKKAISELP
    • Molecular weight19 kDa including tags
    • Amino acids1 to 147
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105593 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab105593 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 200mM Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • AIF 1
    • AIF-1
    • Aif1
    • AIF1 protein
    • AIF1_HUMAN
    • Allograft inflammatory factor 1
    • Allograft inflammatory factor 1 splice variant G
    • allograft inflammatory factor-1 splice variant Hara-1
    • balloon angioplasty responsive transcription
    • BART 1
    • G1
    • G1 putative splice variant of allograft inflamatory factor 1
    • IBA 1
    • IBA1
    • interferon gamma responsive transcript
    • Interferon responsive transcript 1
    • interferon responsive transcript factor 1
    • Ionized calcium binding adapter molecule 1
    • ionized calcium-binding adapter molecule
    • Ionized calcium-binding adapter molecule 1
    • IRT 1
    • IRT1
    • Microglia response factor
    • MRF1
    • Protein g1
    see all
  • FunctionActin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.
  • Tissue specificityDetected in T-lymphocytes and peripheral blood mononuclear cells.
  • Sequence similaritiesContains 2 EF-hand domains.
  • Post-translational
    modifications
    Phosphorylated on serine residues.
  • Cellular localizationCytoplasm > cytoskeleton. Cell projection > ruffle membrane. Associated with the actin cytoskeleton at membrane ruffles and at sites of phagocytosis.
  • Information by UniProt

Recombinant Human Iba1 protein images

  • 15% SDS-PAGE analysis of 3µg ab105593.

References for Recombinant Human Iba1 protein (ab105593)

ab105593 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105593.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"