Overview

  • Product nameRecombinant Human ICA1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ05084
    • SpeciesHuman
    • SequenceMSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVV ASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRS QGFQDKTRAG
    • Molecular weight38 kDa including tags
    • Amino acids1 to 110

Specifications

Our Abpromise guarantee covers the use of ab116929 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 69 kDa islet cell autoantigen
    • Diabetes mellitus type I autoantigen
    • ICA 1
    • Ica1
    • ICA69
    • ICA69_HUMAN
    • ICAp69
    • Islet cell autoantigen 1
    • Islet cell autoantigen 1 (69kD)
    • Islet cell autoantigen 1 69kDa
    • Islet cell autoantigen 1 isoform
    • Islet cell autoantigen p69
    • OTTHUMP00000200933
    • OTTHUMP00000200934
    • OTTHUMP00000200941
    • OTTHUMP00000200993
    • p69
    see all
  • FunctionMay play a role in neurotransmitter secretion.
  • Tissue specificityExpressed abundantly in pancreas, heart and brain with low levels of expression in lung, kidney, liver and thyroid.
  • Sequence similaritiesContains 1 AH domain.
  • Cellular localizationCytoplasm > cytosol. Golgi apparatus membrane. Cytoplasmic vesicle > secretory vesicle membrane. Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Predominantly cytosolic. Also exists as a membrane-bound form which has been found associated with synaptic vesicles and also with the Golgi complex and immature secretory granules.
  • Information by UniProt

Recombinant Human ICA1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116928 at approximately 37.73 kDa.

References for Recombinant Human ICA1 protein (ab116929)

ab116929 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116929.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"