Recombinant human ICAM1 protein (ab168688)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 98% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: Fc tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human ICAM1 protein
See all ICAM1 proteins and peptides -
Biological activity
Measured by the ability of the immobilized protein to support the adhesion of PMA-stimulated HSB2 human peripheral blood acute lymphoblastic leukemia cells. When 5×104 cells/well are added to ab168688 coated plates (12.5 µg/ml with 100 µl/well), >60% will adhere after PMA 1 hour incubation at 37oC. -
Purity
> 98 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
AQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNR KVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQP VGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVR RDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRV LEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASV SVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGT EVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLE VAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPL PELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLS PRYE -
Predicted molecular weight
76 kDa including tags -
Amino acids
27 to 480 -
Tags
Fc tag C-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab168688 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Measured by the ability of the immobilized protein to support the adhesion of PMA-stimulated HSB2 human peripheral blood acute lymphoblastic leukemia cells. When 5×104 cells/well are added to ab168688 coated plates (12.5 µg/ml with 100 µl/well), >60% will adhere after PMA 1 hour incubation at 37oC. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 5% Trehalose, 0.75% Glycine, 0.6% Tris
Storage buffer:
Lyophilized from 0.22 µm filtered solution in 50 mM tris, 100 mM glycine, pH7.5. Normally Mannitol or Trehalose are added as protectants before lyophilization.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1000 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.
General Info
-
Alternative names
- Antigen identified by monoclonal antibody BB2
- BB 2
- BB2
see all -
Function
ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. In case of rhinovirus infection acts as a cellular receptor for the virus. -
Sequence similarities
Belongs to the immunoglobulin superfamily. ICAM family.
Contains 5 Ig-like C2-type (immunoglobulin-like) domains. -
Post-translational
modificationsMonoubiquitinated, which is promoted by MARCH9 and leads to endocytosis. -
Cellular localization
Membrane. - Information by UniProt
Images
-
Human ICAM-1, Fc Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 98%.
-
Immobilized Human ITGALB2, His tag at 5 µg/mL (100 µL/well) can bind Human ICAM-1, Fc Tag with a linear range of 0.082-1.28 µg/mL.
-
SDS-PAGE analysis of reduced ab168688 stained overnight with Coomassie Blue.
Protein migrates as 100-110 kDa in reduced SDS-PAGE resulting from glycosylation.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab168688 has not yet been referenced specifically in any publications.