Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNR KVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQP VGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVR RDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRV LEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASV SVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGT EVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLE VAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPL PELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLS PRYE
    • Molecular weight
      76 kDa including tags
    • Amino acids
      27 to 480

Specifications

Our Abpromise guarantee covers the use of ab168688 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by the ability of the immobilized protein to support the adhesion of PMA-stimulated HSB2 human peripheral blood acute lymphoblastic leukemia cells. When 5×104 cells/well are added to ab168688 coated plates (12.5 µg/ml with 100 µl/well), >60% will adhere after PMA 1 hour incubation at 37oC.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 98 % SDS-PAGE.

  • Form
    Lyophilised
  • Additional notes
    Measured by the ability of the immobilized protein to support the adhesion of PMA-stimulated HSB2 human peripheral blood acute lymphoblastic leukemia cells. When 5×104 cells/well are added to ab168688 coated plates (12.5 µg/ml with 100 µl/well), >60% will adhere after PMA 1 hour incubation at 37oC.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.00
    Constituents: 5% Trehalose, 0.75% Glycine, 0.6% Tris

    Storage buffer:
    Lyophilized from 0.22 µm filtered solution in 50 mM tris, 100 mM glycine, pH7.5. Normally Mannitol or Trehalose are added as protectants before lyophilization.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1000 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Antigen identified by monoclonal antibody BB2
    • BB 2
    • BB2
    • CD 54
    • CD_antigen=CD54
    • CD54
    • Cell surface glycoprotein P3.58
    • Human rhinovirus receptor
    • ICAM 1
    • ICAM-1
    • ICAM1
    • ICAM1_HUMAN
    • Intercellular adhesion molecule 1
    • intercellular adhesion molecule 1 (CD54), human rhinovirus receptor
    • Major group rhinovirus receptor
    • MALA 2
    • MALA2
    • MyD 10
    • MyD10
    • P3.58
    • Surface antigen of activated B cells, BB2
    see all
  • Function
    ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagement promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. In case of rhinovirus infection acts as a cellular receptor for the virus.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. ICAM family.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications
    Monoubiquitinated, which is promoted by MARCH9 and leads to endocytosis.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab168688 stained overnight with Coomassie Blue.
    Protein migrates as 100-110 kDa in reduced SDS-PAGE resulting from glycosylation.

References

ab168688 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168688.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up