Recombinant Human ICEBERG protein (ab124567)

Overview

  • Product name
    Recombinant Human ICEBERG protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMADQLLRKKRRIFIHSVGAGTINALLDCLL EDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEED PQLASKMGLH
    • Molecular weight
      12 kDa including tags
    • Amino acids
      1 to 90
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124567 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab124567 was purified by conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • CAR18_HUMAN
    • CARD18
    • Caspase 1 inhibitor Iceberg
    • Caspase recruitment domain family member 18
    • Caspase recruitment domain-containing protein 18
    • Caspase-1 inhibitor Iceberg
    • ICEBERG caspase 1 inhibitor
    • Pseudo ICE
    • UNQ5804
    • UNQ5804/PRO19611
    see all
  • Function
    Inhibits generation of IL-1-beta by interacting with caspase-1 and preventing its association with RIP2. Down-regulates the release of IL1B.
  • Tissue specificity
    Primarily expressed in the heart and placenta.
  • Sequence similarities
    Contains 1 CARD domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab124567.

References

ab124567 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab124567.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up