Recombinant Human ICEBERG protein (ab124567)

Overview

  • Product nameRecombinant Human ICEBERG protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP57730
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMADQLLRKKRRIFIHSVGAGTINALLDCLL EDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEED PQLASKMGLH
    • Molecular weight12 kDa including tags
    • Amino acids1 to 90
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124567 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab124567 was purified by conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • CAR18_HUMAN
    • CARD18
    • Caspase 1 inhibitor Iceberg
    • Caspase recruitment domain family member 18
    • Caspase recruitment domain-containing protein 18
    • Caspase-1 inhibitor Iceberg
    • ICEBERG caspase 1 inhibitor
    • Pseudo ICE
    • UNQ5804
    • UNQ5804/PRO19611
    see all
  • FunctionInhibits generation of IL-1-beta by interacting with caspase-1 and preventing its association with RIP2. Down-regulates the release of IL1B.
  • Tissue specificityPrimarily expressed in the heart and placenta.
  • Sequence similaritiesContains 1 CARD domain.
  • Information by UniProt

Recombinant Human ICEBERG protein images

  • 15% SDS-PAGE analysis of 3 µg ab124567.

References for Recombinant Human ICEBERG protein (ab124567)

ab124567 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124567.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"