Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLRE VKSLKKLNHANVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPES AIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREI RSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLF PGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVPNNLKTLI PNASSEAVQLLRDMLQWDPKKRPTASQVFFHFLVITFISNSE
    • Amino acids
      1 to 292
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161444 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2210420N10Rik
    • AI848300
    • ECO
    • Heart serine threonine protein kinase
    • hICK
    • Intestinal cell (MAK like) kinase
    • Intestinal cell kinase
    • KIAA0936
    • Laryngeal cancer kinase 2
    • LCK2
    • MAK related kinase
    • MGC46090
    • mICK
    • MRK
    • OTTMUSP00000041856
    • OTTMUSP00000041857
    • Serine/threonine protein kinase ICK
    see all
  • Relevance
    ICK may play a key role in the development of multiple organ systems and particularly in cardiac development.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • ab161444 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161444 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161444.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up