Recombinant Human ICOS Ligand protein (ab161599)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQ NSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQS LGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNV YWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIEN VLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVV AVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
    • Amino acids
      20 to 302
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B7 H2
    • B7 homolog 2
    • B7 homologue 2
    • B7 like protein Gl50
    • B7 related protein 1
    • B7-H2
    • B7-like protein Gl50
    • B7-related protein 1
    • B7H2
    • B7RP 1
    • B7RP-1
    • B7RP1
    • CD 275
    • CD275
    • CD275 antigen
    • GL 50
    • GL50
    • ICOS L
    • ICOS LG
    • ICOS ligand
    • ICOSL
    • ICOSL_HUMAN
    • Icoslg
    • Inducible T cell co stimulator ligand
    • KIAA0653
    • LICOS
    • Transmembrane protein B7 H2 ICOS ligand
    see all
  • Function
    Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion; induces also B-cell proliferation and differentiation into plasma cells. Could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function.
  • Tissue specificity
    Isoform 1 is widely expressed (brain, heart, kidney, liver, lung, pancreas, placenta, skeletal muscle, bone marrow, colon, ovary, prostate, testis, lymph nodes, leukocytes, spleen, thymus and tonsil), while isoform 2 is detected only in lymph nodes, leukocytes and spleen. Expressed on activated monocytes and dendritic cells.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab161599 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up