Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARC KAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDY ILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGA VNKQGDSILCR
    • Molecular weight
      44 kDa including tags
    • Amino acids
      1 to 161

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bHLHb27
    • Class B basic helix-loop-helix protein 27
    • DNA binding protein inhibitor ID 4
    • DNA binding protein inhibitor ID4
    • DNA-binding protein inhibitor ID-4
    • ID 4
    • Id4
    • ID4_HUMAN
    • IDB4
    • Inhibitor of DNA binding 4
    • Inhibitor of DNA binding 4 dominant negative helix loop helix protein
    see all
  • Function
    ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human ID4 protein images

  • ab114442 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human ID4 protein (ab114442)

ab114442 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114442.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up