Recombinant Human IDH3A protein (ab114559)

Overview

  • Product nameRecombinant Human IDH3A protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP50213
    • SpeciesHuman
    • SequenceMAGPAWISKVSRLLGAFHNPKQVTRGFTGGVQTVTLIPGDGIGPEISAAV MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK TPIAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDVNIVTIRENTE GEYSGIEHVIVDGVVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHK ANIMRMSDGLFLQKCREVAESCKDIKFNEMYLDTVCLNMVQDPSQFDVLV MPNLYGDILSDLCAGLIGGLGVTPSGNIGANGVAIFESVHGTAPDIAGKD MANPTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAK CSDFTEEICRRVKDLD
    • Molecular weight66 kDa
    • Amino acids1 to 366

Specifications

Our Abpromise guarantee covers the use of ab114559 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • H IDH alpha
    • HIDH alpha
    • IDH3A
    • IDH3A_HUMAN
    • Isocitrate dehydrogenase
    • Isocitrate dehydrogenase (NAD+) alpha chain precursor
    • Isocitrate dehydrogenase [NAD] subunit alpha
    • Isocitrate dehydrogenase [NAD] subunit alpha mitochondrial
    • Isocitrate dehydrogenase 3 (NAD+) alpha
    • Isocitric dehydrogenase
    • Isocitric dehydrogenase subunit alpha
    • mitochondrial
    • NAD
    • NAD(+)-specific ICDH subunit alpha
    • NAD(H) specific isocitrate dehydrogenase alpha subunit precursor
    • NAD+ specific ICDH
    • NADsubunit alpha mitochondrial precursor
    • OTTHUMP00000184906
    see all
  • Sequence similaritiesBelongs to the isocitrate and isopropylmalate dehydrogenases family.
  • Cellular localizationMitochondrion.
  • Information by UniProt

Recombinant Human IDH3A protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human IDH3A protein (ab114559)

ab114559 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

This protein has not been tested for activity.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"