Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIFSEQTIPPSAK YGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDI RNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKS LPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRI AEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFEN MIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYG HVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYAASIRK AVLASMDNENMHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA
    • Molecular weight
      69 kDa including tags
    • Amino acids
      1 to 393

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116942 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • H IDHG
    • IDH gamma
    • IDH3G
    • IDH3G_HUMAN
    • Isocitrate dehydrogenase [NAD] subunit gamma
    • Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
    • Isocitrate dehydrogenase 3 (NAD+) gamma
    • Isocitric dehydrogenase
    • Isocitric dehydrogenase subunit gamma
    • mitochondrial
    • NAD (H) specific isocitrate dehydrogenase gamma subunit
    • NAD(+) specific ICDH
    • NAD(+)-specific ICDH subunit gamma
    • NAD+ specific ICDH
    • OTTHUMP00000025984
    • OTTHUMP00000025985
    • OTTHUMP00000025987
    • OTTHUMP00000025988
    • OTTHUMP00000214764
    see all
  • Sequence similarities
    Belongs to the isocitrate and isopropylmalate dehydrogenases family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116942 at approximately 69.34kDa stained with Coomassie Blue.

References

ab116942 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116942.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up