Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP51553
    • SpeciesHuman
    • SequenceMALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIFSEQTIPPSAK YGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDI RNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKS LPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRI AEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFEN MIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYG HVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYAASIRK AVLASMDNENMHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA
    • Molecular weight69 kDa including tags
    • Amino acids1 to 393

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116942 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • H IDHG
    • IDH gamma
    • IDH3G
    • IDH3G_HUMAN
    • Isocitrate dehydrogenase [NAD] subunit gamma
    • Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
    • Isocitrate dehydrogenase 3 (NAD+) gamma
    • Isocitric dehydrogenase
    • Isocitric dehydrogenase subunit gamma
    • mitochondrial
    • NAD (H) specific isocitrate dehydrogenase gamma subunit
    • NAD(+) specific ICDH
    • NAD(+)-specific ICDH subunit gamma
    • NAD+ specific ICDH
    • OTTHUMP00000025984
    • OTTHUMP00000025985
    • OTTHUMP00000025987
    • OTTHUMP00000025988
    • OTTHUMP00000214764
    see all
  • Sequence similaritiesBelongs to the isocitrate and isopropylmalate dehydrogenases family.
  • Cellular localizationMitochondrion.
  • Information by UniProt

Recombinant Human IDH3G protein images

  • 12.5% SDS-PAGE showing ab116942 at approximately 69.34kDa stained with Coomassie Blue.

References for Recombinant Human IDH3G protein (ab116942)

ab116942 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116942.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"