Overview

  • Product name
    Recombinant Human IDI1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMMPEINTNHLDKQQVQLLAEMCILIDENDN KIGAETKKNCHLNENIEK GLLHRAFSVFLFNTENKLLLQQRSDAKITF PGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEE VPP EEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVS KEELKELLKKAASGEIKITPWF KIIAATFLFKWWDNLNHLNQFVDHEK IYRM
    • Molecular weight
      29 kDa including tags
    • Amino acids
      1 to 228
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113598 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • isopentenyl diphosphate dimethylallyl diphosphate isomerase
    • IDI1
    • IDI1_HUMAN
    • IPP isomerase
    • IPP isomerase 1
    • IPPI1
    • Isopentenyl diphosphate Delta isomerase
    • Isopentenyl diphosphate Delta isomerase 1
    • isopentenyl diphosphate dimethylallyl diphosphate isomerase 1
    • Isopentenyl pyrophosphate isomerase 1
    • Isopentenyl-diphosphate Delta-isomerase 1
    • OTTHUMP00000018951
    see all
  • Function
    Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).
  • Pathway
    Isoprenoid biosynthesis; dimethylallyl diphosphate biosynthesis; dimethylallyl diphosphate from isopentenyl diphosphate: step 1/1.
  • Sequence similarities
    Belongs to the IPP isomerase type 1 family.
    Contains 1 nudix hydrolase domain.
  • Cellular localization
    Peroxisome.
  • Information by UniProt

Recombinant Human IDI1 protein images

  • 15% SDS-PAGE analysis of ab113598 (3µg)

References for Recombinant Human IDI1 protein (ab113598)

ab113598 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up