Overview

  • Product name
    Recombinant Human IDI1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMMPEINTNHLDKQQVQLLAEMCILIDENDN KIGAETKKNCHLNENIEK GLLHRAFSVFLFNTENKLLLQQRSDAKITF PGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEE VPP EEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVS KEELKELLKKAASGEIKITPWF KIIAATFLFKWWDNLNHLNQFVDHEK IYRM
    • Molecular weight
      29 kDa including tags
    • Amino acids
      1 to 228
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113598 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • isopentenyl diphosphate dimethylallyl diphosphate isomerase
    • IDI1
    • IDI1_HUMAN
    • IPP isomerase
    • IPP isomerase 1
    • IPPI1
    • Isopentenyl diphosphate Delta isomerase
    • Isopentenyl diphosphate Delta isomerase 1
    • isopentenyl diphosphate dimethylallyl diphosphate isomerase 1
    • Isopentenyl pyrophosphate isomerase 1
    • Isopentenyl-diphosphate Delta-isomerase 1
    • OTTHUMP00000018951
    see all
  • Function
    Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).
  • Pathway
    Isoprenoid biosynthesis; dimethylallyl diphosphate biosynthesis; dimethylallyl diphosphate from isopentenyl diphosphate: step 1/1.
  • Sequence similarities
    Belongs to the IPP isomerase type 1 family.
    Contains 1 nudix hydrolase domain.
  • Cellular localization
    Peroxisome.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab113598 (3µg)

References

ab113598 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up