Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSDINLDWVDRRQLQRLEEMLIVVDENDKV IGADTKRNCHLNENI EKGLLHRAFSVVLFNTKNRILIQQRSDTKVTFPGYFTDSCSSHPLYNPAE LEEKDAIGVRRAAQR RLQAELGIPGEQISPEDIVFMTIYHHKAKSDRIWGEHEICYLLLVRKNVT LNPDPSETKSILYLS QEELWELLEREARGEVKVTPWLRTIAERFLYRWWPHLDDVTPFVELHKIH RV
    • Molecular weight
      29 kDa including tags
    • Amino acids
      1 to 227
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 0.002% PMSF

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names
    • Diphosphate dimethylallyl diphosphate isomerase 2
    • IDI 2
    • IDI2
    • IDI2_HUMAN
    • iIsopentenyl diphosphate delta isomerase 2
    • IPP isomerase 2
    • IPPI 2
    • IPPI2
    • Isopentenyl diphosphate Delta isomerase 2
    • Isopentenyl pyrophosphate isomerase 2
    • Isopentenyl-diphosphate Delta-isomerase 2
    • OTTHUMP00000018952
    see all
  • Function
    Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).
  • Tissue specificity
    Detected in skeletal muscle.
  • Pathway
    Isoprenoid biosynthesis; dimethylallyl diphosphate biosynthesis; dimethylallyl diphosphate from isopentenyl diphosphate: step 1/1.
  • Sequence similarities
    Belongs to the IPP isomerase type 1 family.
    Contains 1 nudix hydrolase domain.
  • Cellular localization
    Peroxisome.
  • Information by UniProt

Images

  • SDS-PAGE gel of ab172177  under non-reduced (lane 1) and reduced (lane 2) conditions

References

ab172177 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172177.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up