Recombinant Human NIPBL protein (ab131913)
Key features and details
- Expression system: Wheat germ
- Suitable for: ELISA, WB, SDS-PAGE
Description
-
Product name
Recombinant Human NIPBL protein -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MKCLPENSAPLIEFANVSQGILLLLMLKQHLKNLCGFSDSKIQKYSPSES AKVYDKAINRKTGVHFHPKQTLDFLRSDMANSKITEEVKRSIVKQYLDFK LLMEHLDPDEEEEEGEVSASTNARNKAITSLLGGGSPKNNTAAETEDDES DGEDRGGGTSGVRRRRSQRISQRIT -
Predicted molecular weight
46 kDa including tags -
Amino acids
2524 to 2697
-
Specifications
Our Abpromise guarantee covers the use of ab131913 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
SDS-PAGE
-
Form
Liquid -
Additional notes
This product was previously labelled as IDN3.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.3% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- CDLS
- Colon tumor susceptibility 2
- Delangin
see all -
Function
Probably plays a structural role in chromatin. Involved in sister chromatid cohesion, possibly by interacting with the cohesin complex. -
Tissue specificity
Widely expressed. Highly expressed in heart, skeletal muscle, fetal and adult liver, fetal and adult kidney. Expressed at intermediates level in thymus, placenta, peripheral leukocyte and small intestine. Weakly or not expressed in brain, colon, spleen and lung. -
Involvement in disease
Cornelia de Lange syndrome 1 -
Sequence similarities
Belongs to the SCC2/Nipped-B family.
Contains 5 HEAT repeats. -
Developmental stage
In embryos, it is expressed in developing limbs and later in cartilage primordia of the ulna and of various hand bones. Sites of craniofacial expression include the cartilage primordium of the basioccipital and basisphenoid skull bones and elsewhere in the head and face, including a region encompassing the mesenchyme adjacent to the cochlear canal. Also expressed in the spinal column, notochord and surface ectoderm sclerotome and what seem to be migrating myoblasts. Expressed in the developing heart in the atrial and ventricular myocardium and in the ventricular tubeculae but absent in the endocardial cushions. Also expressed in the developing esophagus, trachea and midgut loops, in the bronchi of the lung and in the tubules of the metanephros. Expression in organs and tissues not typically affected in CDL (e.g. the developing trachea, bronchi, esophagus, heart and kidney) may reflect a bias towards underreporting of more subtle aspects of the phenotype or problems that typically present later in life. Expressed in the mesenchyme surrounding the cochlear canal possibly reflecting the hearing impairment commonly found. Weakly or not expressed in embryonic brain. -
Domain
Contains one Pro-Xaa-Val-Xaa-Leu (PxVxL) motif, which is required for interaction with chromoshadow domains. This motif requires additional residues -7, -6, +4 and +5 of the central Val which contact the chromoshadow domain. -
Cellular localization
Nucleus. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab131913 has been referenced in 1 publication.
- Nolen LD et al. Regional chromatin decompaction in Cornelia de Lange syndrome associated with NIPBL disruption can be uncoupled from cohesin and CTCF. Hum Mol Genet 22:4180-93 (2013). WB . PubMed: 23760082