Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAG RPSASRGHRKRSRRVLYPRVVRRQLPVEEPNPAKR
    • Amino acids
      1 to 85
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DIF2
    • Differentiation-dependent gene 2 protein
    • GLY96
    • IER3
    • IEX1_HUMAN
    • IEX1L
    • Immediate early protein GLY96
    • Immediate early response 3
    • Immediate early response 3 protein
    • Immediately early gene X 1
    • PACAP-responsive gene 1 protein
    • PRG 1
    • PRG1
    • Protein DIF 2
    • Protein DIF-2
    • Protein PRG1
    • Radiation-inducible immediate-early gene IEX-1
    see all
  • Function
    May play a role in the ERK signaling pathway by inhibiting the dephosphorylation of ERK by phosphatase PP2A-PPP2R5C holoenzyme. Acts also as an ERK downstream effector mediating survival. As a member of the NUPR1/RELB/IER3 survival pathway, may provide pancreatic ductal adenocarcinoma with remarkable resistance to cell stress, such as starvation or gemcitabine treatment.
  • Sequence similarities
    Belongs to the IER3 family.
  • Post-translational
    modifications
    Phosphorylated at Thr-18, Thr-123 and Ser-126 by MAPK1/ERK2 and probably MAPK3/ERK1. Upon phosphorylation by MAPK1/ERK2 and MAPK3/ERK1, acquires the ability to inhibit cell death induced by various stimuli.
    Glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab152930 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152930 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152930.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up