Overview

  • Product name
    Recombinant Human IF3EI protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPE VIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWT KLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPSL EQRFESYYNYCNLFNYILNADGPAPLELPNQWLWDIIDEFIYQFQSFSQY RCKTAKKSEEEIDFLRSNPKIWNVHSVLNVLHSLVDKSNINRQLEVYTSG GDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELN KKSMYSRVPECQVTTYYYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMF QRTTYKYEMINKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKMLR MQKGDPQVYEELFSYSCPKFLSPVVPNYDNVHPNYHKEPFLQQLKVFSDE VQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNL VWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKF EELNRTLKKMGQRP
    • Amino acids
      1 to 564
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162538 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • eIEF associated protein HSPC021
    • EIF3EIP
    • eif3l
    • EIF3L_HUMAN
    • EIF3S11
    • EIF3S6IP
    • Eukaryotic translation initiation factor 3 subunit 6 interacting
    • Eukaryotic translation initiation factor 3 subunit 6-interacting protein
    • Eukaryotic translation initiation factor 3 subunit E-interacting protein
    • Eukaryotic translation initiation factor 3 subunit L
    • eukaryotic translation initiation factor 3, subunit E interacting
    • HSPC021
    • HSPC025
    • MSTP005
    see all
  • Function
    Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation.
  • Sequence similarities
    Belongs to the eIF-3 subunit L family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab162538 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162538 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162538.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up