Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16666-2
    • SpeciesHuman
    • SequenceFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKL TCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF
    • Molecular weight37 kDa including tags
    • Amino acids630 to 729

Specifications

Our Abpromise guarantee covers the use of ab114542 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • IFI16
    • Gamma interferon inducible protein 16
    • Gamma-interferon-inducible protein Ifi16
    • IF16_HUMAN
    • Ifi204
    • IFNGIP1
    • interferon activated gene 204
    • Interferon gamma induced protein IFI 16
    • Interferon gamma inducible protein 16
    • Interferon-inducible myeloid differentiation transcriptional activator
    • p204
    • PYHIN2
    see all
  • RelevanceInterferon (IFN) Inducible 16 (IFI16) protein belongs to a family of HIN 200 human and mouse proteins. IFI16 is a nuclear protein comtaining regulatory domains such as DNA binding domain, transcriptional regulatory domain and DAPIN/PAAD domain. IFI16 has three isotypes A, B, and C (85-95 kDa), which arise as a result of mRNA alternative splicing. All are phosphorylated on serine and threonine residues and can homo and heterodimerize. Expression is restricted to the nuclei of hematopoietic cells, fibroblasts and epithelial cells. IFI16 expression in hematopoietic cells of myeloid lineage is tightly regulated and highly induced in the differentiation and proliferation of the cell. Due to its localization in the nucleus, regulation of protein expression, and ability to bind DNA, it is assumed that IFI16 has a role in transcription regulation of cell differentiation. In addition, it was found that IFI16 can act as a transcriptional repressor and is involved in regulation and activation of p53 in cancer cells.
  • Cellular localizationNucleus. Cytoplasm. Note: Cellular distribution is dependent on the acetylation status of the multipartite nuclear localization signal (NLS); NLS acetylation promotes cytoplasmic localization.

Recombinant Human IFI16 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114542

References for Recombinant Human IFI16 protein (ab114542)

ab114542 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114542.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"