Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPL VFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEH TINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSE EELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQF TVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELH DVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG
    • Molecular weight
      58 kDa including tags
    • Amino acids
      1 to 288

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116922 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ21753
    • IFI 35
    • Ifi-35
    • Ifi35
    • IFP 35
    • IFP35
    • IN35
    • IN35_HUMAN
    • Interferon induced 35 kDa protein
    • Interferon-induced 35 kDa protein
    • OTTHUMP00000236626
    • OTTHUMP00000236627
    see all
  • Function
    Not yet known.
  • Tissue specificity
    In a wide range of cell types, including fibroblasts, macrophages, and epithelial cells.
  • Sequence similarities
    Belongs to the NMI family.
  • Cellular localization
    Nucleus. Nuclear following IFN treatment.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE image showing ab116922 at approx 57.75 kDa. Stained with Coomassie Blue.

References

ab116922 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116922.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up