Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPL VFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEH TINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSE EELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQF TVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELH DVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG
    • Molecular weight
      58 kDa including tags
    • Amino acids
      1 to 288

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116922 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ21753
    • IFI 35
    • Ifi-35
    • Ifi35
    • IFP 35
    • IFP35
    • IN35
    • IN35_HUMAN
    • Interferon induced 35 kDa protein
    • Interferon-induced 35 kDa protein
    • OTTHUMP00000236626
    • OTTHUMP00000236627
    see all
  • Function
    Not yet known.
  • Tissue specificity
    In a wide range of cell types, including fibroblasts, macrophages, and epithelial cells.
  • Sequence similarities
    Belongs to the NMI family.
  • Cellular localization
    Nucleus. Nuclear following IFN treatment.
  • Information by UniProt

Recombinant Human IFI35 protein images

  • 12.5% SDS-PAGE image showing ab116922 at approx 57.75 kDa. Stained with Coomassie Blue.

References for Recombinant Human IFI35 protein (ab116922)

ab116922 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116922.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up