Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVL NIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG
    • Amino acids
      189 to 288
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158726 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ21753
    • IFI 35
    • Ifi-35
    • Ifi35
    • IFP 35
    • IFP35
    • IN35
    • IN35_HUMAN
    • Interferon induced 35 kDa protein
    • Interferon-induced 35 kDa protein
    • OTTHUMP00000236626
    • OTTHUMP00000236627
    see all
  • Function
    Not yet known.
  • Tissue specificity
    In a wide range of cell types, including fibroblasts, macrophages, and epithelial cells.
  • Sequence similarities
    Belongs to the NMI family.
  • Cellular localization
    Nucleus. Nuclear following IFN treatment.
  • Information by UniProt

Recombinant Human IFI35 protein images

  • ab158726 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human IFI35 protein (ab158726)

ab158726 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab158726.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up