Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • Accessionp09914
    • SpeciesHuman
    • SequenceLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHRKAEENFQKLL CMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDK SIN
    • Molecular weight37 kDa including tags
    • Amino acids318 to 420

Specifications

Our Abpromise guarantee covers the use of ab114512 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C56
    • G10P1
    • GARG 16
    • GARG16
    • IFI 56
    • IFI 56K
    • IFI-56K
    • IFI56
    • IFIT-1
    • Ifit1
    • IFIT1_HUMAN
    • IFNAI1
    • Interferon alpha inducible protein (MW 56kD)
    • Interferon induced 56 kDa protein
    • Interferon induced protein 56
    • Interferon inducible mRNA 561
    • Interferon-induced 56 kDa protein
    • Interferon-induced protein with tetratricopeptide repeats 1
    • ISG56
    • OTTHUMP00000020062
    • P56
    • RNM561
    see all
  • Sequence similaritiesBelongs to the IFIT family.
    Contains 10 TPR repeats.
  • Information by UniProt

Recombinant Human IFIT1 protein images

  • ab114512 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human IFIT1 protein (ab114512)

ab114512 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114512.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"