Recombinant Human IFITM1 protein (ab152882)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWC CLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGF ILLLVFGSVTVYHIMLQIIQEKRGY
    • Molecular weight
      39 kDa including tags
    • Amino acids
      1 to 125

Specifications

Our Abpromise guarantee covers the use of ab152882 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 9-27
    • CD 225
    • CD 225 antigen
    • CD225
    • CD225 antigen
    • Dispanin subfamily A member 2a
    • DSPA2a
    • IFI 17
    • IFI17
    • IFITM1
    • IFM1_HUMAN
    • Interferon induced protein 17
    • Interferon induced transmembrane protein 1
    • interferon induced transmembrane protein 1 (9-27)
    • Interferon inducible protein 9-27
    • Interferon-induced protein 17
    • Interferon-induced transmembrane protein 1
    • Interferon-inducible protein 9-27
    • Leu 13
    • Leu 13 antigen
    • Leu-13 antigen
    • LEU13
    see all
  • Function
    IFN-induced antiviral protein that mediate cellular innate immunity to at least three major human pathogens, namely influenza A H1N1 virus, West Nile virus, and dengue virus by inhibiting the early step(s) of replication. Plays a key role in the antiproliferative action of IFN-gamma either by inhibiting the ERK activition or by arresting cell growth in G1 phase in a p53-dependent manner. Implicated in the control of cell growth. Component of a multimeric complex involved in the transduction of antiproliferative and homotypic adhesion signals.
  • Sequence similarities
    Belongs to the CD225 family.
  • Post-translational
    modifications
    Palmitoylation on membrane-proximal cysteines controls clustering in membrane compartments and antiviral activity against influenza virus.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152882 stained with Coomassie Blue.

References

ab152882 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152882.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up