Recombinant Human IFN gamma Receptor beta protein (ab169915)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEFSQLPAPQHPKIRLYNAEQVLS WEPVALSNSTRPVVYQVQFKYTDSKWFTADIMSIGVNCTQITATECDFTA ASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVGPPENIEV TPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSIS LDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQ
    • Molecular weight
      28 kDa including tags
    • Amino acids
      28 to 247

Specifications

Our Abpromise guarantee covers the use of ab169915 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab169915 was expressed in E. coli as inclusion bodies, refolded and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris-HCl buffer
    Note: Contains, NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names
    • AF 1
    • AF-1
    • AF1
    • IFGR 2
    • IFGR2
    • IFN-gamma receptor 2
    • IFN-gamma-R2
    • IFNGR 2
    • IFNGR2
    • IFNGT 1
    • IFNGT1
    • IMD28
    • INGR2_HUMAN
    • Interferon gamma receptor 2
    • Interferon gamma receptor 2 (interferon gamma transducer 1)
    • Interferon gamma receptor accessory factor 1
    • Interferon gamma receptor beta chain
    • Interferon gamma receptor chain 2
    • Interferon gamma transducer 1
    see all
  • Function
    Part of the receptor for interferon gamma. Required for signal transduction. This accessory factor is an integral part of the IFN-gamma signal transduction pathway and is likely to interact with GAF, JAK1, and/or JAK2.
  • Involvement in disease
    Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD) [MIM:209950]; also known as familial disseminated atypical mycobacterial infection. This rare condition confers predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine and environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections, with the exception of Salmonella which infects less than 50% of these individuals. The pathogenic mechanism underlying MSMD is the impairment of interferon-gamma mediated immunity, whose severity determines the clinical outcome. Some patients die of overwhelming mycobacterial disease with lepromatous-like lesions in early childhood, whereas others develop, later in life, disseminated but curable infections with tuberculoid granulomas. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.
  • Sequence similarities
    Belongs to the type II cytokine receptor family.
    Contains 2 fibronectin type-III domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab169915 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169915.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up