Recombinant Human IFNA14 protein (ab124549)

Overview

  • Product name
    Recombinant Human IFNA14 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMCNLSQTHSLNNRRTLMLMAQMRRIS PFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSA AWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQ RITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
    • Molecular weight
      22 kDa including tags
    • Amino acids
      24 to 189
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124549 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    Purified by using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • IFN-alpha-14
    • IFN14_HUMAN
    • IFNA14
    • Interferon alpha 14
    • Interferon alpha H
    • Interferon alpha-14
    • Interferon alpha-H
    • Interferon lambda-2-H
    • Interferon lambda2H
    • LeIF H
    • LeIFH
    • MGC125756
    • MGC125757
    see all
  • Function
    Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
  • Sequence similarities
    Belongs to the alpha/beta interferon family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE (3 µg loaded)

References

ab124549 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab124549.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up