Recombinant Human IFNA14 protein (ab124549)

Overview

  • Product name
    Recombinant Human IFNA14 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMCNLSQTHSLNNRRTLMLMAQMRRIS PFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSA AWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQ RITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
    • Molecular weight
      22 kDa including tags
    • Amino acids
      24 to 189
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124549 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    Purified by using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • IFN-alpha-14
    • IFN14_HUMAN
    • IFNA14
    • Interferon alpha 14
    • Interferon alpha H
    • Interferon alpha-14
    • Interferon alpha-H
    • Interferon lambda-2-H
    • Interferon lambda2H
    • LeIF H
    • LeIFH
    • MGC125756
    • MGC125757
    see all
  • Function
    Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
  • Sequence similarities
    Belongs to the alpha/beta interferon family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human IFNA14 protein images

  • 15% SDS-PAGE (3 µg loaded)

References for Recombinant Human IFNA14 protein (ab124549)

ab124549 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124549.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up