Recombinant Human IFNAR1 protein (ab114292)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP17181
    • SpeciesHuman
    • SequenceKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVTFSFDYQKTGMDNWIKLS GCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSFTPFRKAQ
    • Molecular weight37 kDa including tags
    • Amino acids28 to 127

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114292 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha type antiviral protein
    • AVP
    • Beta type antiviral protein
    • CRF2-1
    • Cytokine receptor class-II member 1
    • Cytokine receptor family 2 member 1
    • IFN alpha REC
    • IFN alpha receptor
    • IFN alpha/beta Receptor alpha
    • IFN beta receptor
    • IFN-alpha/beta receptor 1
    • IFN-R-1
    • IFNAR
    • Ifnar1
    • IFNBR
    • IFRC
    • INAR1_HUMAN
    • Interferon (alpha beta and omega) receptor 1
    • Interferon alpha/beta receptor 1
    • Interferon alpha/beta receptor alpha chain
    • Interferon beta receptor 1
    • Type I interferon receptor 1
    see all
  • FunctionAssociates with IFNAR2 to form the type I interferon receptor. Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta-subunits themselves.
  • Tissue specificityIFN receptors are present in all tissues and even on the surface of most IFN-resistant cells. Isoform 1, isoform 2 and isoform 3 are expressed in the IFN-alpha sensitive myeloma cell line U266S. Isoform 2 and isoform 3 are expressed in the IFN-alpha resistant myeloma cell line U266R. Isoform 1 is not expressed in IFN-alpha resistant myeloma cell line U266R.
  • Sequence similaritiesBelongs to the type II cytokine receptor family.
    Contains 3 fibronectin type-III domains.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues by TYK2 tyrosine kinase.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human IFNAR1 protein images

  • ab114292 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human IFNAR1 protein (ab114292)

ab114292 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114292.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"