Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYG VKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSE EFAVCRDGKIGPPKLDIRKE EKQIMIDIFHPSVFVNGDEQEVDYDPET TCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCV SAEGVLHVWGVTTEKSKEVCITIFNSSIKG
    • Molecular weight
      52 kDa including tags
    • Amino acids
      18 to 245
    • Additional sequence information
      Fused with Fc fragment of Human IgG1 at the C-terminus (AAH05333).

Specifications

Our Abpromise guarantee covers the use of ab181887 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 200 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Antiviral Protein Type II
    • Antiviral protein, type 2
    • AVP type II
    • AVP, type 2
    • CD 119
    • CD119
    • CD119 antigen
    • CDw119
    • FLJ45734
    • IFN gamma R
    • IFN gamma R alpha
    • IFN gamma R1
    • IFN-gamma receptor 1
    • IFN-gamma-R1
    • IFNG R1
    • IFNGR
    • IFNGR 1
    • IFNGR1
    • Immune interferon receptor 1
    • Immune interferon receptor for
    • INGR1_HUMAN
    • Interferon gamma receptor 1
    • Interferon gamma receptor alpha chain
    • Interferon gamma receptor alpha chain precursor
    see all
  • Function
    Receptor for interferon gamma. Two receptors bind one interferon gamma dimer.
  • Involvement in disease
    Defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease (MSMD) [MIM:209950]; also known as familial disseminated atypical mycobacterial infection. This rare condition confers predisposition to illness caused by moderately virulent mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine and environmental non-tuberculous mycobacteria, and by the more virulent Mycobacterium tuberculosis. Other microorganisms rarely cause severe clinical disease in individuals with susceptibility to mycobacterial infections, with the exception of Salmonella which infects less than 50% of these individuals. The pathogenic mechanism underlying MSMD is the impairment of interferon-gamma mediated immunity whose severity determines the clinical outcome. Some patients die of overwhelming mycobacterial disease with lepromatous-like lesions in early childhood, whereas others develop, later in life, disseminated but curable infections with tuberculoid granulomas. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.
  • Sequence similarities
    Belongs to the type II cytokine receptor family.
    Contains 2 fibronectin type-III domains.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Post-translational
    modifications
    Phosphorylated at Ser/Thr residues.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab181887 stained overnight with Coomassie Blue. 

    Lane 1: DTT-reduced

    Lane 2: Non-reduced 

     

    As a result of glycosylation, DTT-reduced protein migrates as 75-100 kDa and non-reduced protein migrates as 150-170 kDa.

References

This product has been referenced in:
  • Qiao LN  et al. Effect of electroacupuncture on thermal pain threshold and expression of calcitonin-gene related peptide, substance P and ?-aminobutyric acid in the cervical dorsal root ganglion of rats with incisional neck pain. Acupunct Med 35:276-283 (2017). Read more (PubMed: 28600329) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181887.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up