Overview

  • Product name
    Recombinant Human IFT81 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSDQIKFIMDSLNKEPFRKNYNLITFDSLEPMQLLQVLSDVLAEIDPKQL VDIREEMPEQTAKRMLSLLGILKYKPSGNATDMSTFRQGLVIGSKPVIYP VLHWLLQRTNELKKRAYLARFLIKLEVPSEFLQDETVADTNKQYEELMEA FKTLHKEYEQLKISGFSTAEIRKDISAMEEEKDQLIKRVEHLKKRVETAQ NHQWMLKIARQLRVEKEREEYLAQQKQEQKNQLFHAVQRLQRVQNQLKSM RQAAADAKPESLMKRLEEEIKFNLYMVTEKFPKELENKKKELHFLQKVVS EPAMGHSDLLELESKINEINTEINQLIEKKMMRNEPIEGKLSLYRQQASI ISRKKEAKAEELQEAKEKLASLEREASVKRNQTREFDGTEVLKGDEFKRY VNKLRSKSTVFKKKHQIIAELKAEFGLLQRTEELLKQRHENIQQQLQTME EKKGISGYSYTQEELERVSALKSEVDEMKGRTLDDMSEMVKKLYSLVSEK KSALASVIKELRQLRQKYQELTQECDEKKSQYDSCAAGLESNRSKLEQEV RRLREECLQEESRYHYTNCMIKNLEVQLRRATDEMKAYISSDQQEKRKAI REQYTKNTAEQENLGKKLREKQKVIRESHGPNMKQAKMWRDLEQLMECKK QCFLKQQSQTSIGQVIQEGGEDRLIL
    • Amino acids
      1 to 676
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162193 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Carnitine deficiency associated expressed in ventricle 1 isoform 2
    • Carnitine deficiency-associated protein expressed in ventricle 1
    • CDV-1
    • CDV1
    • CDV1R
    • Ift81
    • IFT81_HUMAN
    • intraflagellar transport 81 homolog (Chlamydomonas)
    • Intraflagellar transport protein 81 homolog
    see all
  • Function
    Isoform CDV-1 may be involved in cardiac hypertrophy caused by carnitine deficiency.
    Isoform CDV-1R appears to play a role in development of the testis and spermatogenesis.
  • Tissue specificity
    Highly expressed in testis, moderately in ovary, heart, liver, skeletal muscle, kidney and pancreas, low in prostate, brain, placenta and lung and not detected in spleen, thymus, small intestine and colon. Isoform CDV-1R is abundantly expressed in testis.
  • Information by UniProt

Images

  • ab162193 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162193 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162193.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up