Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCTVSGGSISS YYWSWIRQTAGKGLEWIGYISHSGSTTYNPSLKSRVTLSLDTSKNQFSLR LNSVTAADTAVYYCAHGSSWDFAFDYWGQGTLVTVSSASPTSPKVFPLSL DSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDASGDL YTTSSQLTLPATQCPDGKSVTCHVKHYTNPSQDVTVPCPVPPPPPCCHPR LSLHRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPE RDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTF RPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKY LTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQ KTIDRLAGKPTHVNVSVVMAEVDGTCY
    • Amino acids
      1 to 477
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158743 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A2m marker
    • Ig alpha 2 chain C region
    • IgA constant heavy chain 2
    • IGHA 2
    • IGHA2
    • IGHA2 protein
    • Immunoglobulin A2
    • Immunoglobulin Am2
    • Immunoglobulin heavy constant alpha 2
    • immunoglobulin heavy constant alpha 2 (A2m marker)
    see all
  • Relevance
    Ig alpha is the major immunoglobulin class in body secretions. It may serve both to defend against local infection and to prevent access of foreign antigens to the general immunologic system.
  • Cellular localization
    Secreted

Images

  • ab158743 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158743 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158743.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up