Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFR SCDLRRLEMYCAPLKPAKSA
    • Molecular weight
      8 kDa
    • Amino acids
      49 to 118
    • Additional sequence information
      Mature protein.

Specifications

Our Abpromise guarantee covers the use of ab87177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab87177 was purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: PBS, pH 7.4

General Info

  • Alternative names
    • IBP1
    • IGF I
    • IGF IA
    • IGF IB
    • IGF-I
    • Igf1
    • IGF1_HUMAN
    • IGF1A
    • IGFI
    • IGFIA
    • Insulin like growth factor 1
    • Insulin like growth factor 1 (somatomedin C)
    • Insulin like growth factor IA
    • Insulin like growth factor IB
    • Insulin-like growth factor I
    • Mechano growth factor
    • MGF
    • OTTHUMP00000195080
    • OTTHUMP00000195081
    • OTTHUMP00000195082
    • OTTHUMP00000195083
    • OTTHUMP00000195084
    • Somatomedia C
    • Somatomedin C
    • Somatomedin-C
    see all
  • Function
    The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake.
  • Involvement in disease
    Defects in IGF1 are the cause of insulin-like growth factor I deficiency (IGF1 deficiency) [MIM:608747]. IGF1 deficiency is an autosomal recessive disorder characterized by growth retardation, sensorineural deafness and mental retardation.
  • Sequence similarities
    Belongs to the insulin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 14% SDS-PAGE showing ab87177 (mature protein)

References

ab87177 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab87177.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up