Recombinant Human IGF2BP2 protein (ab153107)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWA IRAIETLSGKVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGL LAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSFK ISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVP TQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGT SEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIE HETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFEN DMLAVNQQANLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTT HSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAVGAIIGKKGAHIK QLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFKAQGRIFGKLKEENF FNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTP DENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK
    • Amino acids
      1 to 598
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153107 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Hepatocellular carcinoma autoantigen p62
    • IF2B2_HUMAN
    • IGF 2 mRNA binding protein 2
    • IGF II mRNA binding protein 2
    • IGF-II mRNA-binding protein 2
    • IGF2 mRNA-binding protein 2
    • Igf2bp2
    • IMP 2
    • IMP-2
    • IMP2
    • Insulin like growth factor 2 mRNA binding protein 2
    • Insulin-like growth factor 2 mRNA-binding protein 2
    • OTTHUMP00000082606
    • OTTHUMP00000082607
    • OTTHUMP00000082608
    • p62
    • VICKZ 2
    • VICKZ family member 2
    • VICKZ2
    see all
  • Function
    Binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Binding is isoform-specific. May regulate translation of target mRNAs.
  • Tissue specificity
    Expressed in oocytes, granulosa cells of small and growing follicles, Leydig cells, spermatogonia and semen (at protein level). Expressed in testicular cancer (at protein level). Expressed weakly in heart, placenta, skeletal muscle, bone marrow, colon, kidney, salivary glands, testis and pancreas. Detected in fetal liver, fetal ovary, gonocytes and interstitial cells of the testis.
  • Sequence similarities
    Belongs to the RRM IMP/VICKZ family.
    Contains 4 KH domains.
    Contains 2 RRM (RNA recognition motif) domains.
  • Domain
    The third and fourth KH domains are important for binding to the untranslated region (UTR) of target mRNA.
  • Cellular localization
    Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Localizes at the connecting piece and the tail of the spermatozoa.
  • Information by UniProt

Images

  • ab153107 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153107 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153107.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up