Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCALSE GQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYL LPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKK GHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFL NVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTT KGKEDVHCYSMQSK
    • Molecular weight
      31 kDa
    • Amino acids
      28 to 291
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab155611 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute ab155611 in sterile deionized water or buffer. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Acid stable subunit of the 140 K IGF complex
    • Binding protein 29
    • Binding protein 53
    • BP 53
    • BP53
    • Growth hormone dependent binding protein
    • IBP 3
    • IBP-3
    • IBP3
    • IBP3_HUMAN
    • IGF binding protein 3
    • IGF-binding protein 3
    • IGFBP 3
    • IGFBP-3
    • IGFBP3
    • Insulin Like Growth Factor Binding Protein 3
    • Insulin-like growth factor binding protein 3 precursor
    • Insulin-like growth factor-binding protein 3
    see all
  • Function
    IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
  • Tissue specificity
    Expressed by most tissues. Present in plasma.
  • Sequence similarities
    Contains 1 IGFBP N-terminal domain.
    Contains 1 thyroglobulin type-1 domain.
  • Developmental stage
    IGFBP3 levels are higher during extrauterine life and peak during puberty.
  • Domain
    The thyroglobulin type-1 domain mediates interaction with HN.
  • Post-translational
    modifications
    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab155611 stained overnight with Coomassie Blue.

References

ab155611 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155611.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up