Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP17936
    • SpeciesHuman
    • SequenceGASSGGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCALSE GQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYL LPAPPAPGNASESEEDRSAGEVESPSVSSTHRVSDPKFHPLHSKIIIIKK GHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFL NVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTT KGKEDVHCYSMQSK
    • Molecular weight29 kDa
    • Additional sequence information264 amino acid residues

Associated products

Specifications

Our Abpromise guarantee covers the use of ab49831 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The ED50 was determined by its ability to inhibit IGF-II induced proliferation of MCF-7. The expected ED50 for this effect is ≤ 0.2 µg/ml in presence of 15 ng/ml of human IGF-II.

  • Applications

    Inhibition Assay

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    Greater than 98% by SDS-PAGE and HPLC analyses.
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 20mM Sodium citrate, pH 4
    Endotoxin level is less than 0.1 ng per µg (1EU/µg).

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionReconstitute with water to a concentration of 0.1-1.0mg/ml.

General Info

  • Alternative names
    • Acid stable subunit of the 140 K IGF complex
    • Binding protein 29
    • Binding protein 53
    • BP 53
    • BP53
    • Growth hormone dependent binding protein
    • IBP 3
    • IBP-3
    • IBP3
    • IBP3_HUMAN
    • IGF binding protein 3
    • IGF-binding protein 3
    • IGFBP 3
    • IGFBP-3
    • IGFBP3
    • Insulin Like Growth Factor Binding Protein 3
    • Insulin-like growth factor binding protein 3 precursor
    • Insulin-like growth factor-binding protein 3
    see all
  • FunctionIGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
  • Tissue specificityExpressed by most tissues. Present in plasma.
  • Sequence similaritiesContains 1 IGFBP N-terminal domain.
    Contains 1 thyroglobulin type-1 domain.
  • Developmental stageIGFBP3 levels are higher during extrauterine life and peak during puberty.
  • DomainThe thyroglobulin type-1 domain mediates interaction with HN.
  • Post-translational
    modifications
    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant human IGFBP3 protein (ab49831)

ab49831 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab49831.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"