Recombinant Human IGFBP4 protein (ab151630)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYT PRCGSGLRCY PPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPC SAHDRRCLQK HFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSR THEDLYIIPI PNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQ LADSFREVDHHHHHH
    • Molecular weight
      27 kDa including tags
    • Amino acids
      22 to 258
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151630 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab151630 is greater than 95% pure as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    pH: 7.20
    Constituents: 99.2% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • AI875747
    • BP 4
    • BP4
    • Deb2
    • HT29 IGFBP
    • IBP 4
    • IBP-4
    • IBP4
    • IBP4_HUMAN
    • IGF binding protein 4
    • IGF-binding protein 4
    • IGF-BP4
    • IGFBP 4
    • IGFBP-4
    • IGFBP4
    • Insulin Like Growth Factor Binding Protein 4
    • Insulin-like growth factor-binding protein 4
    see all
  • Function
    IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
  • Sequence similarities
    Contains 1 IGFBP N-terminal domain.
    Contains 1 thyroglobulin type-1 domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab151630 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151630.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up