Recombinant Human IGFBP4 protein (ab182836)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEFDEAIHCPPCSEEKLARCRPPV GCEELVREPGCGCCATCALGLGMPCGVYTPRCGSGLRCYPPRGVEKPLHT LMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQKH FAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSRT HEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLE PKGELDCHQLADSFRE
    • Molecular weight
      29 kDa including tags
    • Amino acids
      22 to 258
    • Additional sequence information
      Constructed with codon optimization and expressed with a small T7-His-TEV cleavage site tag (29aa) fusion at its N-terminal (NP_001543).

Specifications

Our Abpromise guarantee covers the use of ab182836 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab182836 was expressed in E.coli as inclusion bodies, refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names
    • AI875747
    • BP 4
    • BP4
    • Deb2
    • HT29 IGFBP
    • IBP 4
    • IBP-4
    • IBP4
    • IBP4_HUMAN
    • IGF binding protein 4
    • IGF-binding protein 4
    • IGF-BP4
    • IGFBP 4
    • IGFBP-4
    • IGFBP4
    • Insulin Like Growth Factor Binding Protein 4
    • Insulin-like growth factor-binding protein 4
    see all
  • Function
    IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
  • Sequence similarities
    Contains 1 IGFBP N-terminal domain.
    Contains 1 thyroglobulin type-1 domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab182836 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182836.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up