Recombinant Human IGFBP7 protein (ab174414)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSSSSDTCGPCEPASCPPLPPLGCLLGET RDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAG GPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSK GTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGV QRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNS QGQASASAKITVVDALHEIPVKKGEGAEL
    • Molecular weight
      29 kDa including tags
    • Amino acids
      27 to 282
    • Tags
      His tag N-Terminus
    • Additional sequence information
      (NCBI Accession No. NP_001544).

Specifications

Our Abpromise guarantee covers the use of ab174414 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab174414 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • AGM
    • Angiomodulin
    • FSTL2
    • IBP-7
    • IBP7
    • IBP7_HUMAN
    • IGF binding protein 7
    • IGF-binding protein 7
    • IGFBP rP1
    • IGFBP-7
    • IGFBP-rP1
    • IGFBP7
    • IGFBPRP1
    • Insulin like growth factor binding protein 7
    • Insulin-like growth factor-binding protein 7
    • MAC25
    • MAC25 protein
    • PGI2 stimulating factor
    • PGI2-stimulating factor
    • Prostacyclin stimulating factor
    • Prostacyclin-stimulating factor
    • PSF
    • RAMSVPS
    • TAF
    • Tumor-derived adhesion factor
    see all
  • Function
    Binds IGF-I and IGF-II with a relatively low affinity. Stimulates prostacyclin (PGI2) production. Stimulates cell adhesion.
  • Sequence similarities
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 Kazal-like domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174414 (3 µg).

References

ab174414 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174414.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up