Recombinant Human IGFBP7 protein (ab50195)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGA GRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTT YPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQ VYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEK HEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKK GEGAEL
    • Molecular weight
      26 kDa
    • Amino acids
      27 to 282

Specifications

Our Abpromise guarantee covers the use of ab50195 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

  • Reconstitution
    Reconstitute to 1mg/ml using sterile water.

General Info

  • Alternative names
    • AGM
    • Angiomodulin
    • FSTL2
    • IBP-7
    • IBP7
    • IBP7_HUMAN
    • IGF binding protein 7
    • IGF-binding protein 7
    • IGFBP rP1
    • IGFBP-7
    • IGFBP-rP1
    • IGFBP7
    • IGFBPRP1
    • Insulin like growth factor binding protein 7
    • Insulin-like growth factor-binding protein 7
    • MAC25
    • MAC25 protein
    • PGI2 stimulating factor
    • PGI2-stimulating factor
    • Prostacyclin stimulating factor
    • Prostacyclin-stimulating factor
    • PSF
    • RAMSVPS
    • TAF
    • Tumor-derived adhesion factor
    see all
  • Function
    Binds IGF-I and IGF-II with a relatively low affinity. Stimulates prostacyclin (PGI2) production. Stimulates cell adhesion.
  • Sequence similarities
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 Kazal-like domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab50195 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for your telephone enquiry this morning. As discussed on the telephone, this antibody can be reconstituted in sterile distilled water. If you include a carrier protein such as BSA, we recommend storing in working aliquots at -20oC for at ...

Read More

Thank you for your enquiry. With regards to our ab50195, we only make the non-glycosylated form of IGFBP7 and there is no information/data on glycolysated forms. Therefore, we are unable to say whether the glycosylated version would act the same or...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up