Recombinant Human IGFBP7 protein (ab50195)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ16270
    • SpeciesHuman
    • SequenceSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGA GRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTT YPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQ VYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEK HEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKK GEGAEL
    • Molecular weight26 kDa
    • Amino acids27 to 282

Specifications

Our Abpromise guarantee covers the use of ab50195 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level< 0.100 Eu/µg
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

  • ReconstitutionReconstitute to 1mg/ml using sterile water.

General Info

  • Alternative names
    • AGM
    • Angiomodulin
    • FSTL2
    • IBP-7
    • IBP7
    • IBP7_HUMAN
    • IGF binding protein 7
    • IGF-binding protein 7
    • IGFBP rP1
    • IGFBP-7
    • IGFBP-rP1
    • IGFBP7
    • IGFBPRP1
    • Insulin like growth factor binding protein 7
    • Insulin-like growth factor-binding protein 7
    • MAC25
    • MAC25 protein
    • PGI2 stimulating factor
    • PGI2-stimulating factor
    • Prostacyclin stimulating factor
    • Prostacyclin-stimulating factor
    • PSF
    • RAMSVPS
    • TAF
    • Tumor-derived adhesion factor
    see all
  • FunctionBinds IGF-I and IGF-II with a relatively low affinity. Stimulates prostacyclin (PGI2) production. Stimulates cell adhesion.
  • Sequence similaritiesContains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 Kazal-like domain.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant Human IGFBP7 protein (ab50195)

ab50195 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your telephone enquiry this morning. As discussed on the telephone, this antibody can be reconstituted in sterile distilled water. If you include a carrier protein such as BSA, we recommend storing in working aliquots at -20oC for at ...

Read More

Thank you for your enquiry. With regards to our ab50195, we only make the non-glycosylated form of IGFBP7 and there is no information/data on glycolysated forms. Therefore, we are unable to say whether the glycosylated version would act the same or...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"