Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEFGLSWVLLVVFLQGVQCEVQLVDSGGGLVQPGGSLRLSCAASGFIVSD HYVEWVRQAPGKGPEWVGCFRSKAHKSTTEYAASVKGRFTILRDDSKNSV HLQMNSLKTDDTAVYYCVRDLEGAGKYDWYFDIWGRGILVTVSSASTKGP SVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGD TTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPC PRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFK WYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSD IAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCS VMHEALHNRFTQKSLSLSPGK
    • Amino acids
      1 to 521
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158746 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686H11213
    • FLJ39988
    • FLJ40036
    • FLJ40253
    • FLJ40587
    • FLJ40789
    • FLJ40834
    • HDC
    • Heavy chain disease protein
    • Ig gamma 3 chain C region
    • IGHG3
    • Immunoglobulin heavy constant gamma 3 (G3m marker)
    • MGC45809
    see all
  • Relevance
    IgG3, like IgG1, activates complement and has an affinity for fc receptors; thus IgG1 and IgG3 are the more effective of the IgG subclasses. An IgG3 deficiency is associated with Wiscott-Aldrich disease, systemic lupus erythematosus, juvenile diabetes mellitus, and peridontal infections. IgG anti-viral antibodies are restricted to IgG subclasses 1 and 3, with IgG3 antibodies being the first to appear in response to infection.
  • Cellular localization
    Secreted

Images

  • ab158746 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158746 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158746.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up