Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP01591
    • SpeciesHuman
    • SequenceMKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSED PNEDIVERNIRIIVPLNNRENISDPTSPLRTRFVYHLSDLCKKCDPTEVE LDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVYGGETKMVETA LTPDACYPD
    • Molecular weight44 kDa including tags
    • Amino acids1 to 159

Specifications

Our Abpromise guarantee covers the use of ab116756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • IGCJ
    • IGJ_HUMAN
    • Immunoglobulin J chain
    • Immunoglobulin J polypeptide linker protein for immunoglobulin alpha and mu polypeptides
    • immunoglobulin joining chain
    • JCH
    • JCHAIN
    • Joining chain of multimeric IgA and IgM
    see all
  • FunctionServes to link two monomer units of either IgM or IgA. In the case of IgM, the J chain-joined dimer is a nucleating unit for the IgM pentamer, and in the case of IgA it induces larger polymers. It also help to bind these immunoglobulins to secretory component.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human IGJ protein images

  • 12.5% SDS-PAGE analysis of ab116756 at approximately 43.60kDa, stained with Coomassie Blue.

References for Recombinant Human IGJ protein (ab116756)

ab116756 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"