Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSED PNEDIVERNIRIIVPLNNRENISDPTSPLRTRFVYHLSDLCKKCDPTEVE LDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVYGGETKMVETA LTPDACYPD
    • Molecular weight
      44 kDa including tags
    • Amino acids
      1 to 159

Specifications

Our Abpromise guarantee covers the use of ab116756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • IGCJ
    • IGJ_HUMAN
    • Immunoglobulin J chain
    • Immunoglobulin J polypeptide linker protein for immunoglobulin alpha and mu polypeptides
    • immunoglobulin joining chain
    • JCH
    • JCHAIN
    • Joining chain of multimeric IgA and IgM
    see all
  • Function
    Serves to link two monomer units of either IgM or IgA. In the case of IgM, the J chain-joined dimer is a nucleating unit for the IgM pentamer, and in the case of IgA it induces larger polymers. It also help to bind these immunoglobulins to secretory component.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab116756 at approximately 43.60kDa, stained with Coomassie Blue.

References

ab116756 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up