Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNYYWGQRTLVTVSSGSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLP DSITFSWKYKNNSDISSTRGFPSVLRGGKYAATSQVLLPSKDVMQGTDEH VVCKVQHPNGNKEKNVPLPVIAELPPKVSVFVPPRDGFFGNPRKSKLICQ ATGFSPRQIQVSWLREGKQVGSGVTTDQVQAEAKESGPTTYKVTSTLTIK ESDWLGQSMFTCRVDHRGLTFQQNASSMCVPDQDTAIRVFAIPPSFASIF LTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNATFSAV GEASICEDDWNSGERFTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLP PAREQLNLRESATITCLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMPE PQAPGRYFAHSILTVSEEEWNTGETYTCVVAHEALPNRVTERTVDKSTEG EVSADEEGFENLWATASTFIVLFLLSLFYSTTVTLFKVK
    • Amino acids
      1 to 489
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158748 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AGM1
    • Constant region of heavy chain of IgM
    • DKFZp686I15196
    • DKFZp686I15212
    • FLJ00385
    • Hepatitis B virus receptor binding protein
    • Ig mu chain C region
    • IGHM
    • IgM heavy chain constant region
    • Immunoglobulin heavy constant mu
    • Immunoglobulin mu chain
    • Imunoglobulin heavy chain
    • Imunoglobulin heavy chain constant region mu
    • Imunoglobulin heavy chain mu constant region
    • MGC104996
    • MGC52291
    • MU
    • VH
    see all
  • Relevance
    IgM normally constitutes about 10% of serum immunoglobulins. IgM antibody is prominent in early immune responses to most antigens and predominates in certain antibody responses such as 'natural' blood group antibodies. IgM (with IgD) is the major immunoglobulin expressed on the surface of B cells. The gene for the mu constant region contains four domains separated by short intervening sequences. Class specific anti immunoglobulin antibodies are useful for: The characterization of malignant B cell proliferations. All but acute lymphocytic leukemias share either surface or intra cytoplasmic Ig with an isotypic restriction, which suggest the monoclonal nature of the cell population. Most of the chronic lymphocytic leukemias, non Hodgkin lymphomas and Burkitt's lymphoma bear surface IgM, whereas plasmocytes from Waldenström's disease bear intracytoplasmic IgM. The other isotypes are less frequently found. On the other hand multiple myelomas are usually of the IgG or IgA type. Characterization of plasma cells in inflammatory conditions: Plasma cell typing can be of use for the classification of intestinal inflammatory conditions such as inflammatory bowel disease and allergic conditions. In the latter a specific increase in the number of IgE plasma cells can be demonstrated.
  • Cellular localization
    Isoform 1: Secreted. During differentiation, B lymphocytes switch from expression of membrane bound IgM to secretion of IgM. Isoform 2: Cell membrane; Single pass type I membrane protein.

Images

  • ab158748 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158748 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158748.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up