Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VVAGLYPKPTLTAHPGPIMAPGESLNLRCQGPIYGMTFALMRVEDLEKSF YHKKTIKNEANFFFQSLKIQDTGHYLCFYYDASYRGSLLSD
    • Amino acids
      220 to 310
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • IGCD1
    • IGDC1
    • Immunoglobulin like domain containing protein 1
    • Immunoglobulin superfamily member 1
    • InhBP
    • Inhibin binding protein
    • KIAA0364
    • MGC75490
    • p120
    • PGSF2
    • Pituitary gland specific factor 2
    see all
  • Relevance
    IGSF1 is a member of the immunoglobulin (Ig) superfamily. They have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.
  • Cellular localization
    Isoforms 1 and 2: Membrane; Multipass membrane protein (Potential). Isoform 3: Secreted (Potential).

Images

  • ab158753 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158753 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158753.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up