Recombinant Human IGSF11 protein (ab165647)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSLVELLLWWNCFSRTGVAASLEVSESPGSIQVARGQTAVLPCTFTTSAA LINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPAT NVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQI QGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVT IRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGLIAGAIGTGA VIIIFCIALILGAFFYWRSKNKEEEEEEIPNEIREDDLPPKCSSAKAFHT EISSSDNNTLTSSNAYNSRYWSNNPKVHRNTESVSHFSDLGQSFSFHSGN ANIPSIYANGTHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKPRPPHT HSYTISHATLERIGAVPVMVPAQSRAGSLV
    • Amino acids
      1 to 430
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • brain and testis specific immunoglobin superfamily protein
    • BTIGSF
    • CXADR like 1
    • CXADRL1
    • Igsf13
    • immunoglobulin superfamily member 11
    • Immunoglobulin superfamily member 11 precursor
    • MGC35227
    • V set and immunoglobulin domain containing 3
    • V set and immunoglobulin domain containing protein 3
    • VSIG3
    see all
  • Relevance
    IGSF11 functions as a cell adhesion molecule through homophilic interaction. IGSF11 stimulates cell growth. IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor (CXADR; MIM 602621) and endothelial cell-selective adhesion molecule (ESAM).
  • Cellular localization
    Cell Membrane, Single-pass type I membrane protein

Images

  • ab165647 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165647 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up