Recombinant Human IGSF11 protein (Tagged) (ab190392)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEFEVSESPGSIQVARGQPAVLPC TFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGF TGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPP SAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQD QVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIG
    • Molecular weight
      46 kDa
    • Amino acids
      24 to 241
    • Tags
      His-T7 tag N-Terminus
    • Additional sequence information
      Extracellular domain. Constructed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at the N-terminal. (NP_689751).

Specifications

Our Abpromise guarantee covers the use of ab190392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab190392 was refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Also contains NaCl, KCl, EDTA, arginine, DTT and Sucrose.

General Info

  • Alternative names
    • brain and testis specific immunoglobin superfamily protein
    • BTIGSF
    • CXADR like 1
    • CXADRL1
    • Igsf13
    • immunoglobulin superfamily member 11
    • Immunoglobulin superfamily member 11 precursor
    • MGC35227
    • V set and immunoglobulin domain containing 3
    • V set and immunoglobulin domain containing protein 3
    • VSIG3
    see all
  • Relevance
    IGSF11 functions as a cell adhesion molecule through homophilic interaction. IGSF11 stimulates cell growth. IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor (CXADR; MIM 602621) and endothelial cell-selective adhesion molecule (ESAM).
  • Cellular localization
    Cell Membrane, Single-pass type I membrane protein

References

ab190392 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190392.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up