Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TLSVTQPWYLEVDYTHEAVTIKCTFSATGCPSEQPTCLWFRYGAHRPENL CLDGCKSEADKFTVREALKENQVSLTVNRVTSNDSAIYICGIAFPSVPEA RAKQTGGGTTLVVREIKLLSKELRNFLTALVSLLSVYVTGVCVAFILLSK SKSNPLRNKKIKEDSQKKKSARRIFQEIAQELYHKRHVETNQQSEKDNNT YENRRVLSNYERP
    • Amino acids
      29 to 241
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Donwregulated by activation gene
    • DORA
    • Down regulated by activation (immunoglobulin superfamily)
    • IgSF6
    • IGSF6_HUMAN
    • Immunoglobulin superfamily member 6
    • Protein DORA
    see all
  • Tissue specificity
    Expressed in peripheral blood lymphocytes, spleen and lymph node, with low levels in thymus, bone marrow and fetal liver. No expression in non-immune tissues.
  • Sequence similarities
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160909 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160909 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160909.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up