Overview

  • Product name
    Recombinant Human IGSF9 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SSFLRSPETPPVSPRESLPGAVVGAGATAEPPYTALADWTLRERLLPGLL PAAP RGSLTSQSSGRGSASFLRPPSTAPSAGGSYLSPAPGDTSSWASG PERWPRREHV VTVSKRRNTSVDENYEWDSEFPGDMELLETLHLGLASS RLRPEAEPELGVKTPE EGCLLNTAHVTGPEARCAALREEFLAFRRRRD ATRARLPAYRQPVPHPEQATLL
    • Amino acids
      948 to 1163

Specifications

Our Abpromise guarantee covers the use of ab91831 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Form
    Lyophilised
  • Additional notes
    Protein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • Reconstitution
    Reconstitute with 27 µl distilled water.

General Info

  • Alternative names
    • Dasm1
    • Dendrite arborization and synapse maturation protein 1
    • IGSF9 immunoglobulin superfamily, member 9
    • IGSF9A
    • Immunoglobulin superfamily member 9A
    • immunoglobulin superfamily, member 9
    • Ncaml
    • Nrt1
    • Protein turtle homolog A
    see all
  • Relevance
    IGSF9 belongs to the immunoglobulin superfamily, turtle family. It contains 2 fibronectin type III domains and 5 Ig like (immunoglobulin-like) domains. It functions in dendrite outgrowth and synapse maturation.
  • Cellular localization
    Cell membrane; Single-pass type I membrane protein.

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images colored control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

ab91831 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab91831.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up