Overview

  • Product nameRecombinant Human IGSF9 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceSSFLRSPETPPVSPRESLPGAVVGAGATAEPPYTALADWTLRERLLPGLL PAAP RGSLTSQSSGRGSASFLRPPSTAPSAGGSYLSPAPGDTSSWASG PERWPRREHV VTVSKRRNTSVDENYEWDSEFPGDMELLETLHLGLASS RLRPEAEPELGVKTPE EGCLLNTAHVTGPEARCAALREEFLAFRRRRD ATRARLPAYRQPVPHPEQATLL
    • Amino acids948 to 1163

Specifications

Our Abpromise guarantee covers the use of ab91831 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • FormLyophilised
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 27 µl distilled water.

General Info

  • Alternative names
    • Dasm1
    • Dendrite arborization and synapse maturation protein 1
    • IGSF9 immunoglobulin superfamily, member 9
    • IGSF9A
    • Immunoglobulin superfamily member 9A
    • immunoglobulin superfamily, member 9
    • Ncaml
    • Nrt1
    • Protein turtle homolog A
    see all
  • RelevanceIGSF9 belongs to the immunoglobulin superfamily, turtle family. It contains 2 fibronectin type III domains and 5 Ig like (immunoglobulin-like) domains. It functions in dendrite outgrowth and synapse maturation.
  • Cellular localizationCell membrane; Single-pass type I membrane protein.

Recombinant Human IGSF9 protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images colored control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Recombinant Human IGSF9 protein (ab91831)

ab91831 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab91831.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"