Overview

  • Product name
    Recombinant Human IKAP protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNS TANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLL
    • Amino acids
      1242 to 1331
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160072 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp781H1425
    • DYS
    • Dysautonomia (Riley Day syndrome hereditary sensory autonomic neuropathy type III)
    • Elongator complex protein 1
    • ELP 1
    • ELP1
    • ELP1_HUMAN
    • FD
    • FLJ12497
    • IKAP
    • IkappaB kinase complex associated protein
    • IkappaB kinase complex-associated protein
    • ikbkap
    • IKI 3
    • IKI3
    • IKK complex associated protein
    • IKK complex-associated protein
    • Inhibitor of kappa light polypeptide gene enhancer in B cells kinase complex associated protein
    • OTTHUMP00000063889
    • p150
    • TOT 1
    • TOT1
    see all
  • Function
    May act as a scaffold protein that may assemble active IKK-MAP3K14 complexes (IKKA, IKKB and MAP3K14/NIK).
    Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.
  • Involvement in disease
    Defects in IKBKAP are the cause of hereditary sensory and autonomic neuropathy type 3 (HSAN3) [MIM:223900]; also known as Riley-Day syndrome or familial dysautonomia (FD). This autosomal recessive disorder is due to the poor development and survival, and progressive degeneration of the sensory, sympathetic and parasympathetic neurons. HSAN3 individuals are affected with a variety of symptoms such as decreased sensitivity to pain and temperature, cardiovascular instability, recurrent pneumonias, vomiting crises, and gastrointestinal dysfunction. It is primarily confined to individuals of Ashkenazi Jewish descent, with an incidence of 1/3'600 live births.
  • Sequence similarities
    Belongs to the ELP1/IKA1 family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab160072 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160072 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160072.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up