Recombinant Human IKB alpha protein (ab113133)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP25963
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMFQAAERPQEWAMEGPRDGLKKERLLDDRH DSGLDSMKDEEYEQMVKE LQEIRLEPQEVPRGSEPWKQQLTEDGDSFL HLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQ PEI AEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSIL KATNYNGHTCLHLASIHGYLGI VELLVSLGADVNAQEPCNGRTALHLA VDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLT LENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL
    • Molecular weight38 kDa including tags
    • Amino acids1 to 317
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113133 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab113133 was purified by using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • I kappa B alpha
    • I-kappa-B-alpha
    • IkappaBalpha
    • IkB-alpha
    • IKBA
    • IKBA_HUMAN
    • IKBalpha
    • MAD 3
    • MAD3
    • Major histocompatibility complex enhancer-binding protein MAD3
    • NF kappa B inhibitor alpha
    • NF-kappa-B inhibitor alpha
    • NFKBI
    • NFKBIA
    • Nuclear factor of kappa light chain gene enhancer in B cells
    • Nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor alpha
    see all
  • FunctionInhibits the activity of dimeric NF-kappa-B/REL complexes by trapping REL dimers in the cytoplasm through masking of their nuclear localization signals. On cellular stimulation by immune and proinflammatory responses, becomes phosphorylated promoting ubiquitination and degradation, enabling the dimeric RELA to translocate to the nucleus and activate transcription.
  • Involvement in diseaseEctodermal dysplasia, anhidrotic, with T-cell immunodeficiency autosomal dominant
  • Sequence similaritiesBelongs to the NF-kappa-B inhibitor family.
    Contains 5 ANK repeats.
  • Post-translational
    modifications
    Phosphorylated; disables inhibition of NF-kappa-B DNA-binding activity. Phosphorylation at positions 32 and 36 is prerequisite to recognition by UBE2D3 leading to polyubiquitination and subsequent degradation.
    Sumoylated; sumoylation requires the presence of the nuclear import signal. Sumoylation blocks ubiquitination and proteasome-mediated degradation of the protein thereby increasing the protein stability.
    Monoubiquitinated at Lys-21 and/or Lys-22 by UBE2D3. Ubiquitin chain elongation is then performed by CDC34 in cooperation with the SCF(FBXW11) E3 ligase complex, building ubiquitin chains from the UBE2D3-primed NFKBIA-linked ubiquitin. The resulting polyubiquitination leads to protein degradation. Also ubiquitinated by SCF(BTRC) following stimulus-dependent phosphorylation at Ser-32 and Ser-36.
    Deubiquitinated by porcine reproductive and respiratory syndrome virus Nsp2 protein, which thereby interferes with NFKBIA degradation and impairs subsequent NF-kappa-B activation.
  • Cellular localizationCytoplasm. Nucleus. Shuttles between the nucleus and the cytoplasm by a nuclear localization signal (NLS) and a CRM1-dependent nuclear export.
  • Information by UniProt

Recombinant Human IKB alpha protein images

  • 15% SDS-PAGE analysis of 3 µg ab113133.

References for Recombinant Human IKB alpha protein (ab113133)

ab113133 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113133.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"