Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEDIQTNAELKSTQEQSVPAESAAVLNDYSLTKSHEMENVDSGEGPAN EDEDIGDDSMKVKDEYSERDENVLKSEPMGNAEEPEIPYSYSREYNEYEN IKLERHVVSFDSSRPTSGKMNCDVCGLSCISFNVLMVHKRSHTGERPFQC NQCGASFTQKGNLLRHIKLHTGEKPFKCHLCNYACQRRDALTGHLRTHSV EKPYKCEFCGRSYKQRSSLEEHKERCRTFLQSTDPGDTASAEARHIKAEM GSERALVLDRLASNVAKRKSSMPQKFIGEKRHCFDVNYNSSYMYEKESEL IQTRMMDQAINNAISYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTR AEMSNGAPQELEKKSIHLPEKSVPSERGLSPNNSGHDSTDTDSNHEERQN HIYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEV MDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSHDRYEFSSH IARGEHRALLK
    • Molecular weight
      82 kDa including tags
    • Amino acids
      1 to 509

Specifications

Our Abpromise guarantee covers the use of ab132618 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AIO
    • Aiolos
    • IKAROS family zinc finger 3
    • IKAROS family zinc finger 3 (Aiolos)
    • Ikaros family zinc finger protein 3
    • IKZF 3
    • IKZF3
    • IKZF3_HUMAN
    • zinc finger DNA binding protein Aiolos
    • Zinc finger protein Aiolos
    • Zinc finger protein subfamily 1A 3
    • Zinc finger protein subfamily 1A 3 (Aiolos)
    • Zinc finger protein subfamily 1A, member 3
    • ZNFN1A3
    see all
  • Function
    Transcription factor that plays an important role in the regulation of lymphocyte differentiation. Plays an essential role in regulation of B-cell differentiation, proliferation and maturation to an effector state. Involved in regulating BCL2 expression and controlling apoptosis in T-cells in an IL2-dependent manner.
  • Tissue specificity
    Expressed most strongly in peripheral blood leukocytes, the spleen, and the thymus.
  • Sequence similarities
    Belongs to the Ikaros C2H2-type zinc-finger protein family.
    Contains 6 C2H2-type zinc fingers.
  • Post-translational
    modifications
    Phosphorylation on tyrosine residues induced by IL2 is required for dissociation from HRAS and nuclear translocation of IKZF3 in T-cells. Phosphorylation on tyrosine residues induced by IL4 is required for dissociation from Bcl-X(L) in T-cells.
  • Cellular localization
    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132618 stained with Coomassie Blue.

References

ab132618 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132618.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up